PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013626410.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 279aa    MW: 31822.7 Da    PI: 6.513
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013626410.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.95.6e-141966148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEd +l ++    G g+W+ +a+  g+ R++k+c++rw +yl
   XP_013626410.1 19 KGLWSPEEDSRLMQYMISSGQGCWSDVAKNAGLQRCGKSCRLRWINYL 66
                     678*******************************************97 PP

2Myb_DNA-binding50.64.4e-1672115146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++++E+el+++ +  lG++ W+ Ia++++ gRt++++k++w++
   XP_013626410.1  72 RGAFSPQEEELIIRFHSILGNR-WSQIAARLP-GRTDNEIKNFWNS 115
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.4E-221469IPR009057Homeodomain-like
PROSITE profilePS5129414.0951466IPR017930Myb domain
SuperFamilySSF466892.15E-2717113IPR009057Homeodomain-like
SMARTSM007172.6E-101868IPR001005SANT/Myb domain
PfamPF002496.8E-131966IPR001005SANT/Myb domain
CDDcd001672.27E-82266No hitNo description
PROSITE profilePS5129424.9267121IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-2570122IPR009057Homeodomain-like
SMARTSM007179.5E-1671119IPR001005SANT/Myb domain
PfamPF002498.8E-1572115IPR001005SANT/Myb domain
CDDcd001674.30E-1174114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0050832Biological Processdefense response to fungus
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MRKPEVASAA THQVKKMKKG LWSPEEDSRL MQYMISSGQG CWSDVAKNAG LQRCGKSCRL  60
RWINYLRPDL KRGAFSPQEE ELIIRFHSIL GNRWSQIAAR LPGRTDNEIK NFWNSTIKKR  120
LKKMSDTSNL VNNSSSSPDT SDLSNNTTSS LELKDIIGSF MSLQEQGFIN PSFTNTPITN  180
NNPFPAPHMI SHPCNDDFNK YADGFYGVNT GLQGEIYFPP LECQEGDWYK ADINNHLEVM  240
NTNGAENVPE SMRMEEYWDL DQLMSTEVPS FHFNFKQST
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-281712125128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00599PBMTransfer from AT5G12870Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF7382830.0KF738283.1 Brassica napus MYB transcription factor 46 (MYB46.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013626410.10.0PREDICTED: transcription factor MYB46-like
RefseqXP_013674543.10.0PREDICTED: transcription factor MYB46-like
SwissprotQ9LXV21e-161MYB46_ARATH; Transcription factor MYB46
TrEMBLA0A0D3B0V40.0A0A0D3B0V4_BRAOL; Uncharacterized protein
STRINGBra006166.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61152347
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12870.11e-149myb domain protein 46